PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr3P07740_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 194aa    MW: 21925.7 Da    PI: 7.023
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr3P07740_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.62.2e-1853107256
                            T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
               Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                            +k+ +++keq   Lee F+++++++ +++  LAk+l+L+ rqV vWFqNrRa+ k
  GSMUA_Achr3P07740_001  53 KKKLRLSKEQSAFLEESFKEHNTLNPKQKLALAKQLNLQPRQVEVWFQNRRARTK 107
                            678899***********************************************98 PP

2HD-ZIP_I/II129.11.7e-4153143192
            HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                            +kk+rlskeq+++LEesF+e+++L+p++K +la++L+lqprqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+kev+eLr
  GSMUA_Achr3P07740_001  53 KKKLRLSKEQSAFLEESFKEHNTLNPKQKLALAKQLNLQPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCQTLTEENRRLQKEVAELR 140
                            59*************************************************************************************9 PP

            HD-ZIP_I/II  89 eelk 92 
                             +lk
  GSMUA_Achr3P07740_001 141 -ALK 143
                            .555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.24E-1848110IPR009057Homeodomain-like
PROSITE profilePS5007116.68249109IPR001356Homeobox domain
SMARTSM003892.5E-1551113IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.2E-1753107IPR009057Homeodomain-like
CDDcd000862.40E-1553110No hitNo description
PfamPF000468.1E-1653107IPR001356Homeobox domain
PROSITE patternPS00027084107IPR017970Homeobox, conserved site
PfamPF021834.1E-11109143IPR003106Leucine zipper, homeobox-associated
SMARTSM003409.5E-25109152IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MGLDVGRREE EEEEAASGDE EEGGKEDGEV RRGGVVERAS SIVSDEEENG LAKKKLRLSK  60
EQSAFLEESF KEHNTLNPKQ KLALAKQLNL QPRQVEVWFQ NRRARTKLKQ TEVDCEYLKR  120
CCQTLTEENR RLQKEVAELR ALKTTHPFHM HLPATTLSMC PSCERVASTA ADHRPSSFAA  180
LFSKPTPAAP RQPP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1101109RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009392044.11e-116PREDICTED: homeobox-leucine zipper protein HOX11-like
SwissprotA2Z1U11e-82HOX11_ORYSI; Homeobox-leucine zipper protein HOX11
SwissprotQ67UE24e-82HOX11_ORYSJ; Homeobox-leucine zipper protein HOX11
TrEMBLM0SCP11e-141M0SCP1_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr3P07740_0011e-140(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52093363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.12e-61homeobox from Arabidopsis thaliana